Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Translation machinery-associated protein 7B (TMA7B)

This Recombinant Human Translation machinery-associated protein 7B (TMA7B) spans the amino acid sequence from region 1-64. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Translation machinery-associated protein 7B TMA7B

UniProt

A0A024R1R8

Expression Region

1-64

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein
abx067770-01 10 µg

Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein

Sign In for Pricing
View Details
Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein
abx067770-02 50 µg

Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein

Sign In for Pricing
View Details
Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein
abx067770-03 100 µg

Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein

Sign In for Pricing
View Details
Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein
abx067770-04 200 µg

Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein

Sign In for Pricing
View Details
Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein
abx067770-05 500 µg

Rat Leukemia Inhibitory Factor Receptor (LIFR) Protein

Sign In for Pricing
View Details
Dermanyssus gallinae, chicken mite, w.m. *
Ar145d 7.6 x 2.6 cm

Dermanyssus gallinae, chicken mite, w.m. *

Sign In for Pricing
View Details