Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2)

This Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CCDC28A-AS1; GVQW motif-containing protein 2; CCDC28A-AS1 GVQW2

UniProt

A0A096LPI5

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISAHCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Btnl7 Protein Vector (Rat) (pPM-C-HA)
13574026 500 ng

Btnl7 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
EARS2 Adenovirus (Human)
18863051 1.0 mL

EARS2 Adenovirus (Human)

Sign In for Pricing
View Details
Mbtps1 ORF Vector (Mouse) (pORF)
28190014 1.0 µg DNA

Mbtps1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Filaggrin (FITC)
316085-01 50 µg

Filaggrin (FITC)

Sign In for Pricing
View Details
Filaggrin (FITC)
316085-02 100 µg

Filaggrin (FITC)

Sign In for Pricing
View Details
Olr827 Protein Vector (Rat) (pPM-C-HA)
PV291288 500 ng

Olr827 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details