Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2)

This Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CCDC28A-AS1; GVQW motif-containing protein 2; CCDC28A-AS1 GVQW2

UniProt

A0A096LPI5

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISAHCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF39 Antibody
A59455-100UG 100 µg

PRPF39 Antibody

Sign In for Pricing
View Details
Mouse gABA (Gamma-Aminobutyric Acid) ELISA Kit
ELK8591-01 48 Tests

Mouse gABA (Gamma-Aminobutyric Acid) ELISA Kit

Sign In for Pricing
View Details
Mouse gABA (Gamma-Aminobutyric Acid) ELISA Kit
ELK8591-02 96 Tests

Mouse gABA (Gamma-Aminobutyric Acid) ELISA Kit

Sign In for Pricing
View Details
Mouse gABA (Gamma-Aminobutyric Acid) ELISA Kit
ELK8591-03 5x 96 Tests

Mouse gABA (Gamma-Aminobutyric Acid) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CBLL1 Protein
E30P65870A 50 µg

Recombinant Human CBLL1 Protein

Sign In for Pricing
View Details
UBAP1 Polyclonal Antibody, APC Conjugated
bs-6748R-APC 100 µL

UBAP1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details