Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 3 (SGSN1)

This Recombinant Human Small integral membrane protein 10-like protein 3 (SGSN1) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 3; Salivary gland-specific protein SAGSIN1; SMIM10L3 SAGSIN1

UniProt

A0A0C4DGP1

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAALSGLAVRLSRSAAARSYGVFCKGLTRTLLIFFDLAWRLRINFPYLYIVASMMLNVRLQVHIEIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhodiosin (Standard)
HY-N2425R 1 Each

Rhodiosin (Standard)

Sign In for Pricing
View Details
TP73, ID (p53-related Protein, p53-like Transcription Factor, Tumor Protein p73, P73) (AP)
MBS6491570-01 0.2 mL

TP73, ID (p53-related Protein, p53-like Transcription Factor, Tumor Protein p73, P73) (AP)

Sign In for Pricing
View Details
TP73, ID (p53-related Protein, p53-like Transcription Factor, Tumor Protein p73, P73) (AP)
MBS6491570-02 5x 0.2 mL

TP73, ID (p53-related Protein, p53-like Transcription Factor, Tumor Protein p73, P73) (AP)

Sign In for Pricing
View Details
Rabbit 15 deoxy Prostaglandin J2 ELISA kit
GTR10442434 96 Well

Rabbit 15 deoxy Prostaglandin J2 ELISA kit

Sign In for Pricing
View Details
pCMV-NOVA2-3×FLAG-Neo Plasmid
PVT58609 2 µg

pCMV-NOVA2-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
Rabbit Anti-Caspase12/CASP12 Polyclonal Antibody
PAV5500 100 μL

Rabbit Anti-Caspase12/CASP12 Polyclonal Antibody

Sign In for Pricing
View Details