Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2)

This Recombinant Human LBH domain-containing protein 2 (LBHD2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADGRB1 Antibody
KC-8140-01 50 μL

ADGRB1 Antibody

Sign In for Pricing
View Details
ADGRB1 Antibody
KC-8140-02 100 µL

ADGRB1 Antibody

Sign In for Pricing
View Details
ADGRB1 Antibody
KC-8140-03 1 mL

ADGRB1 Antibody

Sign In for Pricing
View Details
HGF (NM_000601) Human Recombinant Protein
TP315593M 100 µg

HGF (NM_000601) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant C1orf50 Antibody
RN-14956-01 50 μL

Recombinant C1orf50 Antibody

Sign In for Pricing
View Details
Recombinant C1orf50 Antibody
RN-14956-02 100 µL

Recombinant C1orf50 Antibody

Sign In for Pricing
View Details