Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 201 (CC201)

This Recombinant Human Coiled-coil domain-containing protein 201 (CC201) spans the amino acid sequence from region 1-187. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 201 CCDC201

UniProt

A0A1B0GTI1

Expression Region

1-187

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEPGVQDLGLSSSEDESPSLAIRSPTLRKPLKHSTPEEAALGWSPRPSGGASYLSGSPMPAHFSQDLASHPAGVSPPATVRKRRLSTLWASKESSLDLSAPGEEPPTSASLTQRQRQRQQQQQQQESLRAKSWAQNPGLPGILNTTGRKRRDPKKRAAAMERVRQWEIYVLQNIEEATQHELTIEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TROP-2 MAb (Clone 77220)
MAB650-500 500 µg

Human TROP-2 MAb (Clone 77220)

Sign In for Pricing
View Details
BDP R6G NHS ester
BIPG2137-01 5 mg

BDP R6G NHS ester

Sign In for Pricing
View Details
BDP R6G NHS ester
BIPG2137-02 25 mg

BDP R6G NHS ester

Sign In for Pricing
View Details
BDP R6G NHS ester
BIPG2137-03 50 mg

BDP R6G NHS ester

Sign In for Pricing
View Details
Anserini DRD1 ELISA Kit
EAD0050 96 Tests

Anserini DRD1 ELISA Kit

Sign In for Pricing
View Details
MRAS Antibody, Biotin conjugated
A77510-50UL 50 μL

MRAS Antibody, Biotin conjugated

Sign In for Pricing
View Details