Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A)

This Recombinant Human Uncharacterized protein CXorf51A (CX05A) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Ethylhexane
sc-496107 50 mg

3-Ethylhexane

Sign In for Pricing
View Details
TYW5 sgRNA CRISPR Lentivector (Human) (Target 2)
K2815803 1.0 µg DNA

TYW5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Goat Calmodulin ELISA kit
GTR10393672 96 Well

Goat Calmodulin ELISA kit

Sign In for Pricing
View Details
Bismuth (III) Nitrate Pentahydrate extrapure AR, 98.5%
19737-01 100 g

Bismuth (III) Nitrate Pentahydrate extrapure AR, 98.5%

Sign In for Pricing
View Details
Bismuth (III) Nitrate Pentahydrate extrapure AR, 98.5%
19737-02 500 g

Bismuth (III) Nitrate Pentahydrate extrapure AR, 98.5%

Sign In for Pricing
View Details
SEC61B (Protein Transport Protein Sec61 Subunit beta) (MaxLight 750) discontinued
133085-ML750 100 µL

SEC61B (Protein Transport Protein Sec61 Subunit beta) (MaxLight 750) discontinued

Sign In for Pricing
View Details