Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A)

This Recombinant Human Uncharacterized protein CXorf51A (CX05A) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PDP3 Antibody [Allophycocyanin]
NBP3-05795APC 0.1 mL

Rabbit Polyclonal PDP3 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
General 5HIAA/5-Hydroxyindoleacetic acid ELISA Kit
E45K00751 96 Tests

General 5HIAA/5-Hydroxyindoleacetic acid ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CARD11/CARMA1 Antibody [Alexa Fluor 647]
NBP2-99265AF647 0.1 mL

Rabbit Polyclonal CARD11/CARMA1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
BNIP3L Antibody / NIX / BCL2/adenovirus E1B 19 kDa-interacting protein 3-like
FY13212 100 µg

BNIP3L Antibody / NIX / BCL2/adenovirus E1B 19 kDa-interacting protein 3-like

Sign In for Pricing
View Details
Kinesis Sleeve FEP Purple 1/16 x 0.042 x 1.55
CHR3445 1 Each

Kinesis Sleeve FEP Purple 1/16 x 0.042 x 1.55

Sign In for Pricing
View Details
Human IL17RA Antibody Pair Set
E-KAB-0494 50 µL & 100 µg

Human IL17RA Antibody Pair Set

Sign In for Pricing
View Details