Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 5 (SPRR5)

This Recombinant Human Small proline-rich protein 5 (SPRR5) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 5 SPRR5

UniProt

A0A1B0GTR4

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQKQCAPPQQCCPPPQQRCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQYCPPPQQTKQPCQPPPKCQEPCAPKCPPPQQCQTSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC62 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-13807R-BF647 100 µL

CCDC62 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Human UTP20 siRNA
abx939284-01 15 nmol

Human UTP20 siRNA

Sign In for Pricing
View Details
Human UTP20 siRNA
abx939284-02 30 nmol

Human UTP20 siRNA

Sign In for Pricing
View Details
pLV3-U6-RNF43-sgRNA3-Cas9-EGFP-Puro Plasmid
PVT49898 2 µg

pLV3-U6-RNF43-sgRNA3-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Urb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4066205 3x 1.0 µg

Urb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Gopc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3662306 1.0 µg DNA

Gopc sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details