Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53)

This Recombinant Human Testis-expressed protein 53 (TEX53) spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF647 conjugate, 0.1mg/mL
BNC472385-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIAA1370 (FAM214A) Human Gene Knockout Kit (CRISPR)
KN419263 1 Kit

KIAA1370 (FAM214A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Paxillin Antibody
RC-5852-01 50 μL

Recombinant Paxillin Antibody

Sign In for Pricing
View Details
Recombinant Paxillin Antibody
RC-5852-02 100 µL

Recombinant Paxillin Antibody

Sign In for Pricing
View Details
Recombinant Paxillin Antibody
RC-5852-03 1 mL

Recombinant Paxillin Antibody

Sign In for Pricing
View Details
ILK (Ab-246) Antibody
8B8115-AAT 50 µg

ILK (Ab-246) Antibody

Sign In for Pricing
View Details