Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 195 (CC195)

This Recombinant Human Coiled-coil domain-containing protein 195 (CC195) spans the amino acid sequence from region 1-201. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 195 CCDC195

UniProt

A0A1B0GUA6

Expression Region

1-201

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEADIQLMRLIQEMRAEIHKLEKENQALRMKLTASSQRASGSGRESGDEREEEAPGQSPATLQGAVSTDAAPAVQEHQGNVMIVRRYSISSSVCSSAVNDPWKSGKSHPKSGILEGQRTLKSLACSPIKKQDMEEKVFATDSLTSNRTSQRASPEHVCGCRDKTKAVSFLLPMDMSSYSKNSSSLKHSPNQATNQLSIIAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPMT1 (NM_001143984) Human Over-expression Lysate
LC428444 20 µg

PTPMT1 (NM_001143984) Human Over-expression Lysate

Sign In for Pricing
View Details
Atrazine
TRC-A794600-1G 1 g

Atrazine

Sign In for Pricing
View Details
C17orf87 (SCIMP) Human Gene Knockout Kit (CRISPR)
KN213295RB 1 Kit

C17orf87 (SCIMP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-405
BCPS-405 1 Unit

Large Capacity Water Purification System BCPS-405

Sign In for Pricing
View Details
SPATC1 (N-term) Rabbit Polyclonal Antibody
AP54004PU-N 400 µL

SPATC1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aggrecan Antibody
OC-497-01 50 μL

Aggrecan Antibody

Sign In for Pricing
View Details