Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C10orf143 (CJ143)

This Recombinant Human Uncharacterized protein C10orf143 (CJ143) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C10orf143 C10orf143

UniProt

A0A1B0GUT2

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDSLALGRWRQRRAEDLQVPGDVKRVCRRLEASGHERGCHQVNACALASWGPEDRELPSRGCLPAPRPESGQGRLSTGISQNGGRSSAQPCPRCIAGESGHFSHTKNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB1B antibody
CAF50286 100 µg

RAB1B antibody

Sign In for Pricing
View Details
MAN2C1 Rabbit Polyclonal Antibody (Biotin)
orb451397 100 µL

MAN2C1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Human Mesoderm induction early response protein 2(MIER2)
AP77511-01 20 µg

Recombinant Human Mesoderm induction early response protein 2(MIER2)

Sign In for Pricing
View Details
Recombinant Human Mesoderm induction early response protein 2(MIER2)
AP77511-02 100 µg

Recombinant Human Mesoderm induction early response protein 2(MIER2)

Sign In for Pricing
View Details
Recombinant Human Mesoderm induction early response protein 2(MIER2)
AP77511-03 1 mg

Recombinant Human Mesoderm induction early response protein 2(MIER2)

Sign In for Pricing
View Details
HIST2H2AC antibody
70R-1603 100 ug

HIST2H2AC antibody

Sign In for Pricing
View Details