Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C10orf143 (CJ143)

This Recombinant Human Uncharacterized protein C10orf143 (CJ143) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C10orf143 C10orf143

UniProt

A0A1B0GUT2

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDSLALGRWRQRRAEDLQVPGDVKRVCRRLEASGHERGCHQVNACALASWGPEDRELPSRGCLPAPRPESGQGRLSTGISQNGGRSSAQPCPRCIAGESGHFSHTKNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moramide Intermediate
TRC-M303090-5MG 5 mg

Moramide Intermediate

Sign In for Pricing
View Details
ABHD4 Rabbit Polyclonal Antibody (HRP)
orb2594909 100 µg

ABHD4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
2-[ (tert-Butylamino) carbonyl]benzoic acid
VAA32035-01 0.5 g

2-[ (tert-Butylamino) carbonyl]benzoic acid

Sign In for Pricing
View Details
2-[ (tert-Butylamino) carbonyl]benzoic acid
VAA32035-02 5 g

2-[ (tert-Butylamino) carbonyl]benzoic acid

Sign In for Pricing
View Details
Mouse Cep350 Pre-designed siRNA Set B
SI102383B 1 Each

Mouse Cep350 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PDCD1 Biosimilar Antibody
orb3183058-01 100 µg

PDCD1 Biosimilar Antibody

Sign In for Pricing
View Details