Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C17orf114 (CQ114)

This Recombinant Human Uncharacterized protein C17orf114 (CQ114) spans the amino acid sequence from region 1-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf114 C17orf114

UniProt

A0A1B0GUV1

Expression Region

1-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGLKGAWCFPWCGCRRQRGTERGAGLSPAAPPDPSPAIAPTMAEGGVPSPGPGAYFSRKARLSFRHQLHDIASANDSTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Goat Affinity Purified Antibody to Mouse IgG (min.x Hu., Bov., Eq.)
RAF-443-1 1 mL

TRITC Conjugated Goat Affinity Purified Antibody to Mouse IgG (min.x Hu., Bov., Eq.)

Sign In for Pricing
View Details
JMJD5 (KDM8) Mouse Monoclonal Antibody [Clone ID: OTI5E8]
CF810952 100 µg

JMJD5 (KDM8) Mouse Monoclonal Antibody [Clone ID: OTI5E8]

Sign In for Pricing
View Details
Human TTMA (TMEM200C) activation kit by CRISPRa
GA118757 1 Kit

Human TTMA (TMEM200C) activation kit by CRISPRa

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
AP20973PU-N 100 µg

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS623257 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
LRFN1 Mouse Monoclonal Antibody [Clone ID: N52B/27]
75-121 100 µL

LRFN1 Mouse Monoclonal Antibody [Clone ID: N52B/27]

Sign In for Pricing
View Details