Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54)

This Recombinant Human Testis-expressed protein 54 (TEX54) spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G protein alpha S (GNAS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12D9]
TA809313AM 100 µL

G protein alpha S (GNAS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12D9]

Sign In for Pricing
View Details
PRKAR1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61856R-BF647-01 20 µL

PRKAR1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
PRKAR1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61856R-BF647-02 100 µL

PRKAR1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Mouse Mpg (NM_010822) AAV Particle
MR204931A1V 250 µL

Mouse Mpg (NM_010822) AAV Particle

Sign In for Pricing
View Details
Rat Enolase, Neuron Specific (NSE) ELISA Kit
BSKR62793-01 48 Tests

Rat Enolase, Neuron Specific (NSE) ELISA Kit

Sign In for Pricing
View Details
Rat Enolase, Neuron Specific (NSE) ELISA Kit
BSKR62793-02 96 Tests

Rat Enolase, Neuron Specific (NSE) ELISA Kit

Sign In for Pricing
View Details