Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IQ domain-containing protein M (IQCM)

This Recombinant Human IQ domain-containing protein M (IQCM) spans the amino acid sequence from region 1-501. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IQ domain-containing protein M IQCM

UniProt

A0A1B0GVH7

Expression Region

1-501

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTEEAMPEKAKCPTLEITKQDFFQEAKTLIAQHYEKINENKVQGTSINVFRKKHQKPKSGKYIPLEIDKKVTRDVVQEHRAALRRICFPKELSKSEHLQEPPQRISFKEPHIFSRRERCRPIDLITKGQVKLDKIMTIIEPVSKKMETAKQQHFEESRNRMLELLYPFPVHLYLQPGTSNLELLKEPDKAFYDWRGFVLTRSFRLACDSRRVSFSQSSSIFRDYYSKTFKTLIKKERQPIKPEPKSQPRIKGTPNKTDKLDSKVKRIGPHIEIFQVFRERKKFMITPKLIRMVTVMQAHVRGWLERKRLQRVMTKALDHGPDMKAVINMYGRLIHRVRYRRGLWRTRQILNLAELEEWMDRKKFYEIMFAKREDWPKIERNELPNFFSDCGHFPTQKQVDDTWDLVHQDGKEKYSELIKKSKAIEMLFTLYPPEGAHVPDSTLLKSTWLRPIVNGEEGYRYIVNGHPALKRANIRVVGKLVARSIRERKMRQHYKSCKVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STYXL2 Human Gene Knockout Kit (CRISPR)
KN417379 1 Kit

STYXL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MPC1L Human Gene Knockout Kit (CRISPR)
KN430973 1 Kit

MPC1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS626553 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
MBOAT2 Human Gene Knockout Kit (CRISPR)
KN420026 1 Kit

MBOAT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Enkephalin (ENK) ELISA Kit
RD-ENK-Mu-01 96 Tests

Mouse Enkephalin (ENK) ELISA Kit

Sign In for Pricing
View Details
Mouse Enkephalin (ENK) ELISA Kit
RD-ENK-Mu-02 48 Tests

Mouse Enkephalin (ENK) ELISA Kit

Sign In for Pricing
View Details