Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 200 (CC200)

This Recombinant Human Coiled-coil domain-containing protein 200 (CC200) spans the amino acid sequence from region 1-168. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 200 CCDC200

UniProt

A0A1B0GVQ3

Expression Region

1-168

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSAYHWEARRRQMALDRRRWLMAQQQQELQQKEQELKNHQEEEQQSEEKLQPHKKLNVPQPPVAKLWTSQEQPQPSQQQPSVQPPSQPPPQPSTLPQAQVWPGPQPPQPQPPPQPTQPSAQARCTQHTSKCNLQDSQRPGLMNPCQSSPIRNTGYSQLKSTNYIQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF811596 100 µg

RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

Sign In for Pricing
View Details
SIRT5 (30-46) Rabbit Polyclonal Antibody
AP08461PU-N 50 µg

SIRT5 (30-46) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(p-Nitrobenzylidene)malonic Acid Diethyl Ester
TRC-N493690-100MG 100 mg

(p-Nitrobenzylidene)malonic Acid Diethyl Ester

Sign In for Pricing
View Details
ARPP21 (NM_001025068) Human Over-expression Lysate
LY422572 100 µg

ARPP21 (NM_001025068) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgM Immunoglobulin (ICO-30), CF405S conjugate, 0.1mg/mL
BNC040364-500 1x 500 µL

Human IgM Immunoglobulin (ICO-30), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human DAO (Diamine Oxidase) ELISA Kit
E-UNEL-H0283-01 5x 96 Tests

Uncoated Human DAO (Diamine Oxidase) ELISA Kit

Sign In for Pricing
View Details