Recombinant Human Coiled-coil domain-containing protein 200 (CC200)
This Recombinant Human Coiled-coil domain-containing protein 200 (CC200) spans the amino acid sequence from region 1-168. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Coiled-coil domain-containing protein 200 CCDC200
UniProt
A0A1B0GVQ3
Expression Region
1-168
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MGSAYHWEARRRQMALDRRRWLMAQQQQELQQKEQELKNHQEEEQQSEEKLQPHKKLNVPQPPVAKLWTSQEQPQPSQQQPSVQPPSQPPPQPSTLPQAQVWPGPQPPQPQPPPQPTQPSAQARCTQHTSKCNLQDSQRPGLMNPCQSSPIRNTGYSQLKSTNYIQQW
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
130874-ML750 100 µL
PARD3 (Partitioning Defective 3 Homolog, PAR-3, PARD-3, Atypical PKC Isotype-specific-interacting Protein, ASIP, CTCL Tumor Antigen se2-5, PAR3-alpha, PAR3, PAR3A, Bazooka, FLJ21015, SE2-5L16, SE2-5LT1, SE2-5T2) (MaxLight 750) discontinued
Sign In for Pricing
View Details