Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 36 (SIM36), partial

This Recombinant Human Small integral membrane protein 36 (SIM36), partial spans the amino acid sequence from region 35-93. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 36 SMIM36

UniProt

A0A1B0GVT2

Expression Region

35-93

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDCRGKDPSKEYAPEATLEAQPSIRLVVMHPSVAGPHWPKGPGLSLGDPAPLGKKSTMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRK1 (NM_024652) Human 3' UTR Clone
SC213666 10 µg

LRRK1 (NM_024652) Human 3' UTR Clone

Sign In for Pricing
View Details
ZNF200 Blocking Peptide
33R-8752 0.1 mg

ZNF200 Blocking Peptide

Sign In for Pricing
View Details
SERCA1 (A-6) HRP
sc-515162 HRP 200 µg/mL

SERCA1 (A-6) HRP

Sign In for Pricing
View Details
EphA3 AAV Vector (Mouse) (CMV)
19356104 1 µg

EphA3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Polk ORF Vector (Rat) (pORF)
ORF073774 1.0 µg DNA

Polk ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
KLC4 Knockout A549 Polyclonal Cells
ARG34488 1 Million

KLC4 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details