Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 36 (SIM36), partial

This Recombinant Human Small integral membrane protein 36 (SIM36), partial spans the amino acid sequence from region 35-93. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 36 SMIM36

UniProt

A0A1B0GVT2

Expression Region

35-93

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDCRGKDPSKEYAPEATLEAQPSIRLVVMHPSVAGPHWPKGPGLSLGDPAPLGKKSTMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SNW1 Protein
E30P2166 20 µg

Recombinant Human SNW1 Protein

Sign In for Pricing
View Details
Polyclonal RTN4RL1 Antibody - middle region
APR13166G 0.05mg

Polyclonal RTN4RL1 Antibody - middle region

Sign In for Pricing
View Details
Lentiviral human ERLEC1 shRNA (UAS) - Lentiviral human ERLEC1 shRNA (UAS, GFP) (100)
GTR15340692 1 Vial

Lentiviral human ERLEC1 shRNA (UAS) - Lentiviral human ERLEC1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Lentiviral human ACTBL2 shRNA (UAS) - Lentiviral human ACTBL2 shRNA (UAS, iRFP) (100)
GTR15343326 1 Vial

Lentiviral human ACTBL2 shRNA (UAS) - Lentiviral human ACTBL2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Prolactin (PRL) Mouse Monoclonal Antibody [Clone ID: OTI2E4]
CF500817 100 µg

Prolactin (PRL) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

Sign In for Pricing
View Details
IL12A siRNA (Rat)
MBS8225477-01 15 nmol

IL12A siRNA (Rat)

Sign In for Pricing
View Details