Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 36 (SIM36), partial

This Recombinant Human Small integral membrane protein 36 (SIM36), partial spans the amino acid sequence from region 35-93. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 36 SMIM36

UniProt

A0A1B0GVT2

Expression Region

35-93

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDCRGKDPSKEYAPEATLEAQPSIRLVVMHPSVAGPHWPKGPGLSLGDPAPLGKKSTMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF7 Peptide
3941P 0.05 mg

IRF7 Peptide

Sign In for Pricing
View Details
NET1 (G-4) PE
sc-271941 PE 200 µg/mL

NET1 (G-4) PE

Sign In for Pricing
View Details
Lentiviral human RGPD3 shRNA (UAS) - Lentiviral human RGPD3 shRNA (UAS, RFP) plasmid
GTR15100741 1 Vial

Lentiviral human RGPD3 shRNA (UAS) - Lentiviral human RGPD3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
LOC503089 3'UTR Luciferase Stable Cell Line
TU210344 1.0 mL

LOC503089 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-TOR1AIP2 Rabbit pAb
GB112937 100 μL

Anti-TOR1AIP2 Rabbit pAb

Sign In for Pricing
View Details
Epalrestat Impurity 39
RM-E161264-01 10 mg

Epalrestat Impurity 39

Sign In for Pricing
View Details