Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 269 (TM269), partial

This Recombinant Human Transmembrane protein 269 (TM269), partial spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 269 TMEM269

UniProt

A0A1B0GVZ9

Expression Region

1-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVLGLFSIIFSFSRKCHYASRMLLVSFLLDMAVRAMTSHINICSKLGAELNDFAVFTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike RBD (Q414R) (His Tag)
PKSV030439 100 µg

Recombinant SARS-CoV-2 Spike RBD (Q414R) (His Tag)

Sign In for Pricing
View Details
Mouse Campylobacter jejuni, clone 57-24 (Monoclonal) Antibody
orb624166 1 mL

Mouse Campylobacter jejuni, clone 57-24 (Monoclonal) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67) [Allophycocyanin]
NB100-105APC 0.1 mL

Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67) [Allophycocyanin]

Sign In for Pricing
View Details
SLC39A7 Antibody
OACA09312-100UL 100 µL

SLC39A7 Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (PE)
168751-AF-PE 100 µL

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (PE)

Sign In for Pricing
View Details
Human MT-ND4 shRNA Plasmid
abx953008-01 150 µg

Human MT-ND4 shRNA Plasmid

Sign In for Pricing
View Details