Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8)

This Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombospondin type-1 domain-containing protein 8 THSD8

UniProt

A0A1W2PP97

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ALVYQDYQYLGQQGEGDSWEQLRLQHLKEVEDSILGPWGKWRCLCDLGKQERSREVVGTAPGPVFMDPEKLIQLRPCRQRDCPSCKPFDCDWRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (MaxLight 650)
MBS6230778-01 0.1 mL

ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (MaxLight 650)

Sign In for Pricing
View Details
ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (MaxLight 650)
MBS6230778-02 5x 0.1 mL

ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (MaxLight 650)

Sign In for Pricing
View Details
Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N1) (FITC)
MBS6262050-01 0.1 mL

Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N1) (FITC)

Sign In for Pricing
View Details
Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N1) (FITC)
MBS6262050-02 5x 0.1 mL

Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N1) (FITC)

Sign In for Pricing
View Details
Boc-Pro-Gly-OH
sc-293929A 25 g

Boc-Pro-Gly-OH

Sign In for Pricing
View Details
Camel Placental Protein 13 ELISA Kit
MBS105421-01 48 Well

Camel Placental Protein 13 ELISA Kit

Sign In for Pricing
View Details