Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8)

This Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombospondin type-1 domain-containing protein 8 THSD8

UniProt

A0A1W2PP97

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ALVYQDYQYLGQQGEGDSWEQLRLQHLKEVEDSILGPWGKWRCLCDLGKQERSREVVGTAPGPVFMDPEKLIQLRPCRQRDCPSCKPFDCDWRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOB2 Protein Vector (Human) (pPM-C-HA)
PV043367 500 ng

TOB2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TNF High Sensitivity ELISA Kit (Human)
OKCD01318-96W 96 Well

TNF High Sensitivity ELISA Kit (Human)

Sign In for Pricing
View Details
Human immunoglobulin heavy chain,IgH ELISA Kit
CN-03789H2 48T

Human immunoglobulin heavy chain,IgH ELISA Kit

Sign In for Pricing
View Details
HIF-1 Alpha Polyclonal Antibody, Cy3 Conjugated
bs-0737R-Cy3 100 µL

HIF-1 Alpha Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Gm11744 3'UTR Luciferase Stable Cell Line
TU107432 1.0 mL

Gm11744 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ACTBP3 Adenovirus (Human)
11238051 1.0 mL

ACTBP3 Adenovirus (Human)

Sign In for Pricing
View Details