Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf90 (CHO90)

This Recombinant Human Uncharacterized protein C8orf90 (CHO90) spans the amino acid sequence from region 1-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C8orf90 C8orf90

UniProt

A0A2R8Y2Y2

Expression Region

1-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASSCPGTPSPAGLPPPSVATPGETLGPAAPPEPAFPDIYGGDAQLWEAHFRGIGRAYRALGKQDDFAIRVLTENFTLPFPFAWPPGSDPACGPLFYDPRDRADFDFLLRGPGASPPALLRPLHATAQAAMRKRRLERLALSCARARGPGPASSCCCPAPPPPSRSPRPALPATAPPGWPRPRRCPESEQNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF148 Antibody
orb2674121-01 50 µL

ZNF148 Antibody

Sign In for Pricing
View Details
ZNF148 Antibody
orb2674121-02 100 µL

ZNF148 Antibody

Sign In for Pricing
View Details
ZNF148 Antibody
orb2674121-03 200 µL

ZNF148 Antibody

Sign In for Pricing
View Details
AKT1-IN-11
HY-179516 1 Each

AKT1-IN-11

Sign In for Pricing
View Details
NR1H2 Rabbit Polyclonal Antibody
orb574685 100 µL

NR1H2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat CD11b ELISA Kit
E110019 1 Each

Rat CD11b ELISA Kit

Sign In for Pricing
View Details