Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ)

This Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ) spans the amino acid sequence from region 16-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretory calcium-binding phosphoprotein proline-glutamine rich 1 SCPPPQ1

UniProt

A0A411D538

Expression Region

16-79

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPIPLEQYAESSSEQRFIFYPPQVPPFFPQVLFPLPPQPPLVLTPNDLIALLIAILNQLGILFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycophenolic Acid Impurity 41
RM-M031641-01 10 mg

Mycophenolic Acid Impurity 41

Sign In for Pricing
View Details
Mycophenolic Acid Impurity 41
RM-M031641-02 25 mg

Mycophenolic Acid Impurity 41

Sign In for Pricing
View Details
Mycophenolic Acid Impurity 41
RM-M031641-03 50 mg

Mycophenolic Acid Impurity 41

Sign In for Pricing
View Details
Mycophenolic Acid Impurity 41
RM-M031641-04 100 mg

Mycophenolic Acid Impurity 41

Sign In for Pricing
View Details
GlycoElute Elution Buffer - CAL/CPA
21511283-2 25 mL

GlycoElute Elution Buffer - CAL/CPA

Sign In for Pricing
View Details
Disitertide (P144)
C06919-1g 1 g

Disitertide (P144)

Sign In for Pricing
View Details