Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tudor domain-containing protein 15 (TDR15), partial

This Recombinant Human Tudor domain-containing protein 15 (TDR15), partial spans the amino acid sequence from region 1011-1070. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tudor domain-containing protein 15 TDRD15

UniProt

B5MCY1

Expression Region

1011-1070

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSNKMRVCISKYVEDGLSYRALAIPTDSSSEFQVYFVDFGNKQLVGENMLRAISAQFPEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1A1L Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12943R-BF350 100 µL

CSNK1A1L Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Complement Component C5aR1 Antibody
NBP3-24692-20ul 20 µL

Rabbit Polyclonal Complement Component C5aR1 Antibody

Sign In for Pricing
View Details
OR2Y1, CT (OR2Y1, Olfactory receptor 2Y1, Olfactory receptor OR5-2) (MaxLight 650)
MBS6328610-01 0.1 mL

OR2Y1, CT (OR2Y1, Olfactory receptor 2Y1, Olfactory receptor OR5-2) (MaxLight 650)

Sign In for Pricing
View Details
OR2Y1, CT (OR2Y1, Olfactory receptor 2Y1, Olfactory receptor OR5-2) (MaxLight 650)
MBS6328610-02 5x 0.1 mL

OR2Y1, CT (OR2Y1, Olfactory receptor 2Y1, Olfactory receptor OR5-2) (MaxLight 650)

Sign In for Pricing
View Details
ADK Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1974875 100 µL

ADK Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
Guinea pig MYH1 (Myosin Heavy Chain 1, Skeletal Muscle, Adult) ELISA Kit
MBS2513506-01 24 Tests

Guinea pig MYH1 (Myosin Heavy Chain 1, Skeletal Muscle, Adult) ELISA Kit

Sign In for Pricing
View Details