Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small lysine-rich protein 1 (SMKR1)

This Recombinant Human Small lysine-rich protein 1 (SMKR1) spans the amino acid sequence from region 1-65. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small lysine-rich protein 1 SMKR1

UniProt

H3BMG3

Expression Region

1-65

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse IgG (H+L) Goat igG Fab'HRP
JP17601E 20 µg

Anti-Mouse IgG (H+L) Goat igG Fab'HRP

Sign In for Pricing
View Details
Lentiviral mouse Polr2e shRNA (UAS) - Lentiviral mouse Polr2e shRNA (UAS, iRFP) plasmid
GTR15171664 1 Vial

Lentiviral mouse Polr2e shRNA (UAS) - Lentiviral mouse Polr2e shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PDK2 Knockout HCT116 Polyclonal Cells
ARG7312 1 Million

PDK2 Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) ASMT1 Polyclonal Antibody
MBS7143702 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) ASMT1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GRHL3 Antibody
NBP1-80356 100 µL

Rabbit Polyclonal GRHL3 Antibody

Sign In for Pricing
View Details
Human Phospholipase A2, Group IID (PLA2G2D) ELISA kit
YLA3194HU-01 48 Tests

Human Phospholipase A2, Group IID (PLA2G2D) ELISA kit

Sign In for Pricing
View Details