Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ARL14 effector protein-like (A14EL)

This Recombinant Human ARL14 effector protein-like (A14EL) spans the amino acid sequence from region 1-152. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARL14 effector protein-like ARL14EPL

UniProt

P0DKL9

Expression Region

1-152

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNEQSEKNNSIQERHTDHSFPEKNCQIGQKQLQQIERQLKCLAFRNPGPQVADFNPETRQQKKKARMSKMNEYFSTKYKIMRKYDKSGRLICNDADLCDCLEKNCLGCFYPCPKCNSNKCGPECRCNRRWVYDAIVTESGEVISTLPFNVPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit
MBS459019-01 48 Tests

Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

Sign In for Pricing
View Details
Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit
MBS459019-02 96 Tests

Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

Sign In for Pricing
View Details
Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit
MBS459019-03 5x 96 Tests

Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

Sign In for Pricing
View Details
Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit
MBS459019-04 10x 96 Tests

Human Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

Sign In for Pricing
View Details
LRP4 Rabbit pAb, BF700 conjugated
orb2870094 100 µL

LRP4 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
PLCG2 Colorimetric Cell-Based ELISA Kit (OKAG00985)
OKAG00985 96 Well

PLCG2 Colorimetric Cell-Based ELISA Kit (OKAG00985)

Sign In for Pricing
View Details