Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1)

This Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 1 SMIM10L1

UniProt

P0DMW3

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIL1 Rabbit pAb
E45R21445N-50 50 µL

PPIL1 Rabbit pAb

Sign In for Pricing
View Details
β-defensin 40 HDR Plasmid (m)
sc-436170-HDR 20 µg

β-defensin 40 HDR Plasmid (m)

Sign In for Pricing
View Details
TRAV3 sgRNA CRISPR Lentivector set (Human)
K2442601 3x 1.0 µg

TRAV3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
HLA-DMB (DMB, RING7, HLA Class II Histocompatibility Antigen, DM beta Chain, MHC Class II Antigen DMB, Really Interesting New Gene 7 Protein) (AP)
MBS6131686-01 0.1 mL

HLA-DMB (DMB, RING7, HLA Class II Histocompatibility Antigen, DM beta Chain, MHC Class II Antigen DMB, Really Interesting New Gene 7 Protein) (AP)

Sign In for Pricing
View Details
HLA-DMB (DMB, RING7, HLA Class II Histocompatibility Antigen, DM beta Chain, MHC Class II Antigen DMB, Really Interesting New Gene 7 Protein) (AP)
MBS6131686-02 5x 0.1 mL

HLA-DMB (DMB, RING7, HLA Class II Histocompatibility Antigen, DM beta Chain, MHC Class II Antigen DMB, Really Interesting New Gene 7 Protein) (AP)

Sign In for Pricing
View Details
Socs7 3'UTR GFP Stable Cell Line
TU169457 1.0 mL

Socs7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details