Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BMPG Recombinant Protein C-6 His Tag
MBS8431365-01 0.05 mg

Human BMPG Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
Human BMPG Recombinant Protein C-6 His Tag
MBS8431365-02 5x 0.05 mg

Human BMPG Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
Cavy Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit
MBS9362954 Inquire

Cavy Long Palate, Lung and Nasal Epithelium Carcinoma Associated Protein 3 (SPLUNC3) ELISA Kit

Sign In for Pricing
View Details
Mouse Metallothionein 2 ELISA Kit
MBS728797-01 48 Well

Mouse Metallothionein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Metallothionein 2 ELISA Kit
MBS728797-02 96 Well

Mouse Metallothionein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Metallothionein 2 ELISA Kit
MBS728797-03 5x 96 Well

Mouse Metallothionein 2 ELISA Kit

Sign In for Pricing
View Details