Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARR3 shRNA (UAS) - Lentiviral human ARR3 shRNA (UAS) plasmid
GTR15143947 1 Vial

Lentiviral human ARR3 shRNA (UAS) - Lentiviral human ARR3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
HDAC1 Rabbit mAb
E60M0374 100 µL

HDAC1 Rabbit mAb

Sign In for Pricing
View Details
HPS6 siRNA (Human)
CRJ2576-01 15 nmol

HPS6 siRNA (Human)

Sign In for Pricing
View Details
HPS6 siRNA (Human)
CRJ2576-02 30 nmol

HPS6 siRNA (Human)

Sign In for Pricing
View Details
Gria2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4332507 1.0 µg DNA

Gria2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Casc1 (NM_177222) Mouse Tagged ORF Clone
MG219222 10 µg

Casc1 (NM_177222) Mouse Tagged ORF Clone

Sign In for Pricing
View Details