Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm8720 Protein Vector (Mouse) (pPM-C-HA)
PV184936 500 ng

Gm8720 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lypd1 (NM_001007727) Rat Untagged Clone
RN204890 10 µg

Lypd1 (NM_001007727) Rat Untagged Clone

Sign In for Pricing
View Details
UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326) (MaxLight 550)
MBS6214682-01 0.1 mL

UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326) (MaxLight 550)

Sign In for Pricing
View Details
UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326) (MaxLight 550)
MBS6214682-02 5x 0.1 mL

UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326) (MaxLight 550)

Sign In for Pricing
View Details
PRKAG3 Peptide - N-terminal region (AAP64048)
AAP64048-100UG 100 µg

PRKAG3 Peptide - N-terminal region (AAP64048)

Sign In for Pricing
View Details
Hoechst 34580
TRC-H747830-250MG 250 mg

Hoechst 34580

Sign In for Pricing
View Details