Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A)

This Recombinant Human Small integral membrane protein 10-like protein 2A (SIL2A) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2A SMIM10L2A LINC00086 NCRNA00086

UniProt

P0DMW4

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FoxO4 (phospho Ser262) Polyclonal Antibody
MBS8586054-01 0.1 mg

FoxO4 (phospho Ser262) Polyclonal Antibody

Sign In for Pricing
View Details
FoxO4 (phospho Ser262) Polyclonal Antibody
MBS8586054-02 0.1 mL (AF405L)

FoxO4 (phospho Ser262) Polyclonal Antibody

Sign In for Pricing
View Details
FoxO4 (phospho Ser262) Polyclonal Antibody
MBS8586054-03 0.1 mL (AF405S)

FoxO4 (phospho Ser262) Polyclonal Antibody

Sign In for Pricing
View Details
FoxO4 (phospho Ser262) Polyclonal Antibody
MBS8586054-04 0.1 mL (AF610)

FoxO4 (phospho Ser262) Polyclonal Antibody

Sign In for Pricing
View Details
FoxO4 (phospho Ser262) Polyclonal Antibody
MBS8586054-05 0.1 mL (AF635)

FoxO4 (phospho Ser262) Polyclonal Antibody

Sign In for Pricing
View Details
FoxO4 (phospho Ser262) Polyclonal Antibody
MBS8586054-06 0.1 mL (APC)

FoxO4 (phospho Ser262) Polyclonal Antibody

Sign In for Pricing
View Details