Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 2B (SIL2B)

This Recombinant Human Small integral membrane protein 10-like protein 2B (SIL2B) spans the amino acid sequence from region 1-78. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 2B SMIM10L2B LINC00087 NCRNA00087

UniProt

P0DMW5

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mid1ip1 3'UTR GFP Stable Cell Line
TU263187 1.0 mL

Mid1ip1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TBX2 Protein Vector (Mouse) (pPB-N-His)
PV236883 500 ng

TBX2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human KLF10 (NM_001032282) AAV Particle
RC202028A1V 250 µL

Human KLF10 (NM_001032282) AAV Particle

Sign In for Pricing
View Details
4- (2,5-dimethylphenyl) tetrahydro-2H-pyran-4-ol
OR1082474-01 250 mg

4- (2,5-dimethylphenyl) tetrahydro-2H-pyran-4-ol

Sign In for Pricing
View Details
4- (2,5-dimethylphenyl) tetrahydro-2H-pyran-4-ol
OR1082474-02 500 mg

4- (2,5-dimethylphenyl) tetrahydro-2H-pyran-4-ol

Sign In for Pricing
View Details
4- (2,5-dimethylphenyl) tetrahydro-2H-pyran-4-ol
OR1082474-03 1 g

4- (2,5-dimethylphenyl) tetrahydro-2H-pyran-4-ol

Sign In for Pricing
View Details