Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 7A (LCE7A)

This Recombinant Human Late cornified envelope protein 7A (LCE7A) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 7A LCE7A

UniProt

P0DV60

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSYQKHQQKWQLPAKCLPKYPSKWTPQAPASCPAPCPPPAPSCCVSSCCISGFGGHCSLVSLRFPRFYLRQPQHSDCCEHESSRCSTCYSSGDCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-RFC5-3xFLAG-CopGFP-Puro Plasmid
PVT70169 2 µg

PLV3-CMV-RFC5-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Klc1 (NM_008450) Mouse Untagged Clone
MC218194 10 µg

Klc1 (NM_008450) Mouse Untagged Clone

Sign In for Pricing
View Details
FBXO4 (NM_001297437) Human Tagged ORF Clone
RG237335 10 µg

FBXO4 (NM_001297437) Human Tagged ORF Clone

Sign In for Pricing
View Details
MMP16 Rabbit Polyclonal Antibody (FITC)
orb2614505 100 µg

MMP16 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
C1orf2 (FAM189B) Human qPCR Primer Pair (NM_006589)
HP209511 200 Reactions

C1orf2 (FAM189B) Human qPCR Primer Pair (NM_006589)

Sign In for Pricing
View Details
Baloxavir marboxil
C11489-1mg 1 mg

Baloxavir marboxil

Sign In for Pricing
View Details