Recombinant Human Protein CD300H (CD3CH), partial, Biotinylated
This Recombinant Human Protein CD300H (CD3CH), partial, Biotinylated spans the amino acid sequence from region 25-168. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein CD300H; CD300 antigen-like family member H; CD300H
UniProt
A0A0K2S4Q6
Expression Region
25-168
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
VSGPSTVMGAVGESLSVQCRYEEKYKTFNKYWCRQPCLPIWHEMVETGGSEGVVRSDQVIITDHPGDLTFTVTLENLTADDAGKYRCGIATILQEDGLSGFLPDPFFQVQVLVSSASSTENSVKTPASPTRPSQCQGSLPSSTC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RPU54565-01 50 µg
Recombinant Horse Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
Sign In for Pricing
View Details RPU54565-02 100 µg
Recombinant Horse Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
Sign In for Pricing
View Details