Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Negative regulator of P-body association (NBDY), Biotinylated

This Recombinant Human Negative regulator of P-body association (NBDY), Biotinylated spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Negative regulator of P-body association; P-body dissociating protein; Protein NoBody; NBDY LINC01420

UniProt

A0A0U1RRE5

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Human IgA,  40nm
GM-17-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgA, 40nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701097 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
1-(5-Fluoropentyl)-1H-indole-3-carboxylic Acid
TRC-F143275-50MG 50 mg

1-(5-Fluoropentyl)-1H-indole-3-carboxylic Acid

Sign In for Pricing
View Details
Copper(II) Nitrate Hemipentahydrate
TRC-C685345-500G 500 g

Copper(II) Nitrate Hemipentahydrate

Sign In for Pricing
View Details
Potassium Hexahydroxyantimonate (KSb(OH)6)
TRC-P698728-25G 25 g

Potassium Hexahydroxyantimonate (KSb(OH)6)

Sign In for Pricing
View Details
Bovine Monocyte Chemotactic Protein 2 (MCP2) ELISA Kit
RD-MCP2-b-01 96 Tests

Bovine Monocyte Chemotactic Protein 2 (MCP2) ELISA Kit

Sign In for Pricing
View Details