Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ubiquitin-related modifier 5 (SUMO5), Biotinylated

This Recombinant Human Small ubiquitin-related modifier 5 (SUMO5), Biotinylated spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 5; SUMO-5; SUMO1 pseudogene 1; Ubiquitin-like 2; Ubiquitin-like 6; SUMO1P1 SUMO5 UBL2 UBL6

UniProt

G2XKQ0

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX2-IP siRNA (m)
sc-63069 10 µM

SSX2-IP siRNA (m)

Sign In for Pricing
View Details
Cdc50B Polyclonal Antibody
E44H04246 100 µL

Cdc50B Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TWEAK/TNFSF12 Antibody (MM0590-10T24) [Alexa Fluor 350]
NBP2-11960AF350 0.1 mL

Mouse Monoclonal TWEAK/TNFSF12 Antibody (MM0590-10T24) [Alexa Fluor 350]

Sign In for Pricing
View Details
Fibulin 2 (FBLN2) (NM_001165035) Human Over-expression Lysate
LH00905V 100 µg

Fibulin 2 (FBLN2) (NM_001165035) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal EBAG9/RCAS1 Antibody [DyLight 488]
NBP3-00242G 0.1 mL

Rabbit Polyclonal EBAG9/RCAS1 Antibody [DyLight 488]

Sign In for Pricing
View Details
(2-Formyl-4,5-methylenedioxy) phenylboronic acid
418108-01 100 mg

(2-Formyl-4,5-methylenedioxy) phenylboronic acid

Sign In for Pricing
View Details