Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 250 (TM250), partial, Biotinylated

This Recombinant Human Transmembrane protein 250 (TM250), partial, Biotinylated spans the amino acid sequence from region 1-55. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 250; Herpes virus UL25-binding protein; TMEM250 C9orf69

UniProt

H0YL14

Expression Region

1-55

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Corynebacterium Diphtheriae rpsT Protein (aa 1-87)
VAng-Lsx2808-500gEcoli 500 µg (E. coli)

Recombinant Corynebacterium Diphtheriae rpsT Protein (aa 1-87)

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone 9F10]
E45M20983V-2 50 µL

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone 9F10]

Sign In for Pricing
View Details
TRIM3 Rabbit Polyclonal Antibody (HRP)
orb2100794 100 µL

TRIM3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Dechloromonas aromatica Probable GTP-binding protein EngB (engB)
MBS1315920-01 0.02 mg (E-Coli)

Recombinant Dechloromonas aromatica Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Dechloromonas aromatica Probable GTP-binding protein EngB (engB)
MBS1315920-02 0.1 mg (E-Coli)

Recombinant Dechloromonas aromatica Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Dechloromonas aromatica Probable GTP-binding protein EngB (engB)
MBS1315920-03 0.02 mg (Yeast)

Recombinant Dechloromonas aromatica Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details