Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon lambda-4 (IFNL4), Biotinylated

This Recombinant Human Interferon lambda-4 (IFNL4), Biotinylated spans the amino acid sequence from region 22-179. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon lambda-4; IFN-lambda-4; IFNL4

UniProt

K9M1U5

Expression Region

22-179

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH3 Antibody
GWB-85AAED 0.05 mg

NOTCH3 Antibody

Sign In for Pricing
View Details
Anti-Mouse PSCA Antibody (SAA2225), PE
MT361137-01 1 Each

Anti-Mouse PSCA Antibody (SAA2225), PE

Sign In for Pricing
View Details
Anti-Mouse PSCA Antibody (SAA2225), PE
MT361137-02 100 Tests

Anti-Mouse PSCA Antibody (SAA2225), PE

Sign In for Pricing
View Details
CCDC126 siRNA (h)
sc-89869 10 µM

CCDC126 siRNA (h)

Sign In for Pricing
View Details
Rabbit Monoclonal Serpin F1/PEDF Antibody (013) [Alexa Fluor 647]
NBP2-89798AF647 0.1 mL

Rabbit Monoclonal Serpin F1/PEDF Antibody (013) [Alexa Fluor 647]

Sign In for Pricing
View Details
PQBP4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1711306 1.0 µg DNA

PQBP4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details