Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon lambda-4 (IFNL4), Biotinylated

This Recombinant Human Interferon lambda-4 (IFNL4), Biotinylated spans the amino acid sequence from region 22-179. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon lambda-4; IFN-lambda-4; IFNL4

UniProt

K9M1U5

Expression Region

22-179

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGP9.5 Rabbit Rabbit Polyclonal Antibody (UCHL-1)
MBS9513141-01 0.05 mL

PGP9.5 Rabbit Rabbit Polyclonal Antibody (UCHL-1)

Sign In for Pricing
View Details
PGP9.5 Rabbit Rabbit Polyclonal Antibody (UCHL-1)
MBS9513141-02 0.1 mL

PGP9.5 Rabbit Rabbit Polyclonal Antibody (UCHL-1)

Sign In for Pricing
View Details
PGP9.5 Rabbit Rabbit Polyclonal Antibody (UCHL-1)
MBS9513141-03 5x 0.1 mL

PGP9.5 Rabbit Rabbit Polyclonal Antibody (UCHL-1)

Sign In for Pricing
View Details
SYTL3 Recombinant Protein Antigen
NBP1-83943PEP 0.1 mL

SYTL3 Recombinant Protein Antigen

Sign In for Pricing
View Details
SH3GL2 Rabbit Polyclonal Antibody
E10G09640 100 µL

SH3GL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Itsn2 (NM_001198968) Mouse Untagged Clone
MC229649 10 µg

Itsn2 (NM_001198968) Mouse Untagged Clone

Sign In for Pricing
View Details