Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial, Biotinylated

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial, Biotinylated spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCAAT/Enhancer Binding Protein Alpha (CEBPA) Antibody
abx231579 100 µg

CCAAT/Enhancer Binding Protein Alpha (CEBPA) Antibody

Sign In for Pricing
View Details
PDRG1 Antibody
orb1315141-01 30 µL

PDRG1 Antibody

Sign In for Pricing
View Details
PDRG1 Antibody
orb1315141-02 50 μL

PDRG1 Antibody

Sign In for Pricing
View Details
PDRG1 Antibody
orb1315141-03 100 µL

PDRG1 Antibody

Sign In for Pricing
View Details
Smad3 discontinued
542376-01 30ul

Smad3 discontinued

Sign In for Pricing
View Details
Smad3 discontinued
542376-02 100 µL

Smad3 discontinued

Sign In for Pricing
View Details