Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial, Biotinylated

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial, Biotinylated spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha 4 (ITGA4) Mouse Monoclonal Antibody [Clone ID: 44H6]
SM1129PS 100 µg

Integrin alpha 4 (ITGA4) Mouse Monoclonal Antibody [Clone ID: 44H6]

Sign In for Pricing
View Details
Bovine NA ELISA Kit
EBN0070 96 Tests

Bovine NA ELISA Kit

Sign In for Pricing
View Details
RASSF4-set siRNA/shRNA/RNAi Lentivector (Human)
38556091 4x 500 ng

RASSF4-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Ptpdc1 ORF Vector (Rat) (pORF)
ORF074300 1.0 µg DNA

Ptpdc1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
NPE-caged-XDP
NU-307S 10 µL

NPE-caged-XDP

Sign In for Pricing
View Details
PPP1R16B Antibody
MBS8527166-01 0.1 mg

PPP1R16B Antibody

Sign In for Pricing
View Details