Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasopressin-neurophysin 2-copeptin (NEU2), partial, Biotinylated

This Recombinant Human Vasopressin-neurophysin 2-copeptin (NEU2), partial, Biotinylated spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vasopressin-neurophysin 2-copeptin; AVP-NPII; [Cleaved into: Arg-vasopressin; Arginine-vasopressin; Neurophysin 2; Neurophysin-II; Copeptin] AVP ARVP VP

UniProt

P01185

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-302d-5p miRNA Antagomir
MBS8316516-01 10 nmol

hsa-miR-302d-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-302d-5p miRNA Antagomir
MBS8316516-02 20 nmol

hsa-miR-302d-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-302d-5p miRNA Antagomir
MBS8316516-03 5x 20 nmol

hsa-miR-302d-5p miRNA Antagomir

Sign In for Pricing
View Details
HUWE1 Antibody
C44150-01 50 µL

HUWE1 Antibody

Sign In for Pricing
View Details
HUWE1 Antibody
C44150-02 100 µL

HUWE1 Antibody

Sign In for Pricing
View Details
OR4G2P sgRNA CRISPR Lentivector (Human) (Target 1)
K1509902 1.0 µg DNA

OR4G2P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details