Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-opiomelanocortin (COLI), partial, Biotinylated

This Recombinant Human Pro-opiomelanocortin (COLI), partial, Biotinylated spans the amino acid sequence from region 237-267. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-opiomelanocortin; POMC; Corticotropin-lipotropin; [Cleaved into: NPP; Melanotropin gamma; Gamma-MSH; Potential peptide; Corticotropin; Adrenocorticotropic hormone; ACTH; Melanocyte-stimulating hormone alpha; Alpha-MSH; Melanotropin alpha; Corticotropin-like intermediary peptide; CLIP; Lipotropin beta; Beta-LPH; Lipotropin gamma; Gamma-LPH; Melanocyte-stimulating hormone beta; Beta-MSH; Melanotropin beta; Beta-endorphin; Met-enkephalin] POMC

UniProt

P01189

Expression Region

237-267

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PADI6, NT (PADI6, Protein-arginine deiminase type-6, Peptidylarginine deiminase VI, Protein-arginine deiminase type VI) (MaxLight 490)
MBS6330445-01 0.1 mL

PADI6, NT (PADI6, Protein-arginine deiminase type-6, Peptidylarginine deiminase VI, Protein-arginine deiminase type VI) (MaxLight 490)

Sign In for Pricing
View Details
PADI6, NT (PADI6, Protein-arginine deiminase type-6, Peptidylarginine deiminase VI, Protein-arginine deiminase type VI) (MaxLight 490)
MBS6330445-02 5x 0.1 mL

PADI6, NT (PADI6, Protein-arginine deiminase type-6, Peptidylarginine deiminase VI, Protein-arginine deiminase type VI) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Protein ARV1, Arv1 ELISA KIT
ELI-49350m 96 Tests

Mouse Protein ARV1, Arv1 ELISA KIT

Sign In for Pricing
View Details
CASP9 Antibody
CSB-PA001240-01 50 µg

CASP9 Antibody

Sign In for Pricing
View Details
CASP9 Antibody
CSB-PA001240-02 100 µg

CASP9 Antibody

Sign In for Pricing
View Details
TRIM38 Antibody - N-terminal region
ARP34799_P050-25UL 25 µL

TRIM38 Antibody - N-terminal region

Sign In for Pricing
View Details