Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycoprotein hormones alpha chain (GLHA), Biotinylated

This Recombinant Human Glycoprotein hormones alpha chain (GLHA), Biotinylated spans the amino acid sequence from region 25-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycoprotein hormones alpha chain; Anterior pituitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha; CG-alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Thyrotropin alpha chain; CGA

UniProt

P01215

Expression Region

25-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (MaxLight 650)
MBS6227027-01 0.1 mL

CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (MaxLight 650)

Sign In for Pricing
View Details
CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (MaxLight 650)
MBS6227027-02 5x 0.1 mL

CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (MaxLight 650)

Sign In for Pricing
View Details
Endothelin Receptor Type B Rabbit Monoclonal Antibody [KD Validation]
E51K2962 40 µL

Endothelin Receptor Type B Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Phosphatase, Alkaline, Placental (Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, ALP, FLJ61142, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1) -PE discontinued
P4071-14E-PE 100 µL

Phosphatase, Alkaline, Placental (Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, ALP, FLJ61142, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1) -PE discontinued

Sign In for Pricing
View Details
Human acidic fibroblast growth factor 1 (aFGF-1) Elisa Kit
EK700135 96 Well

Human acidic fibroblast growth factor 1 (aFGF-1) Elisa Kit

Sign In for Pricing
View Details
COIL Rabbit Polyclonal Antibody
orb2955208-01 50 µg

COIL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details