Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Follitropin subunit beta (FSHB), Biotinylated

This Recombinant Human Follitropin subunit beta (FSHB), Biotinylated spans the amino acid sequence from region 19-129. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Follitropin subunit beta; Follicle-stimulating hormone beta subunit; FSH-B; FSH-beta; Follitropin beta chain; FSHB

UniProt

P01225

Expression Region

19-129

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRMP1 Rabbit pAb, AE conjugated
orb2883287 100 µL

CRMP1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Phospho-Mcl1 (Ser159 + Thr163) Polyclonal Antibody, APC Conjugated
bs-3265R-APC 100 µL

Phospho-Mcl1 (Ser159 + Thr163) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Anti-Triadin/TRDN Antibody Picoband®, PE Conjugate
A06901-PE 100 µg/Vial

Anti-Triadin/TRDN Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
ABCF1 (H-3) Alexa Fluor® 594
sc-377185 AF594 200 µg/mL

ABCF1 (H-3) Alexa Fluor® 594

Sign In for Pricing
View Details
Mouse Bactericidal/Permeability Increasing Protein (BPI) ELISA Kit
RD-BPI-Mu-96Tests 96 Tests

Mouse Bactericidal/Permeability Increasing Protein (BPI) ELISA Kit

Sign In for Pricing
View Details
GIN1 shRNA (m) Lentiviral Particles
sc-145406-V 200 µL

GIN1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details