Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Osteocalcin (OSTCN), Biotinylated

This Recombinant Human Osteocalcin (OSTCN), Biotinylated spans the amino acid sequence from region 52-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein; BGLAP

UniProt

P02818

Expression Region

52-100

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Axin1 Polyclonal Antibody, RBITC Conjugated
bs-2439R-RBITC 100 µL

Axin1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
2- (3-Fluoro-4-phenoxyphenyl) ethan-1-amine
KLB40557-01 50 mg

2- (3-Fluoro-4-phenoxyphenyl) ethan-1-amine

Sign In for Pricing
View Details
2- (3-Fluoro-4-phenoxyphenyl) ethan-1-amine
KLB40557-02 0.5 g

2- (3-Fluoro-4-phenoxyphenyl) ethan-1-amine

Sign In for Pricing
View Details
GALNT1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-13273R-BF750 100 µL

GALNT1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
TMEM80 siRNA (Mouse)
MBS8237187-01 15 nmol

TMEM80 siRNA (Mouse)

Sign In for Pricing
View Details
TMEM80 siRNA (Mouse)
MBS8237187-02 30 nmol

TMEM80 siRNA (Mouse)

Sign In for Pricing
View Details