Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sex hormone-binding globulin (SHBG), Biotinylated

This Recombinant Human Sex hormone-binding globulin (SHBG), Biotinylated spans the amino acid sequence from region 30-402. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sex hormone-binding globulin; SHBG; Sex steroid-binding protein; SBP; Testis-specific androgen-binding protein; ABP; Testosterone-estradiol-binding globulin; TeBG; Testosterone-estrogen-binding globulin; SHBG

UniProt

P04278

Expression Region

30-402

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb23 (NM_001037933) Mouse Tagged Lenti ORF Clone
MR219781L3 10 µg

Defb23 (NM_001037933) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human VEGF121
MBS691490-01 0.002 mg

Human VEGF121

Sign In for Pricing
View Details
Human VEGF121
MBS691490-02 5x 0.002 mg

Human VEGF121

Sign In for Pricing
View Details
Igsf1 Rat shRNA Plasmid (Locus ID 302822)
TR713443 1 Kit

Igsf1 Rat shRNA Plasmid (Locus ID 302822)

Sign In for Pricing
View Details
2-Thiophen-3-yl-pyridin-3-ylamine
sc-321887 1 g

2-Thiophen-3-yl-pyridin-3-ylamine

Sign In for Pricing
View Details
ZNF307 Antibody
28-394 100 µL

ZNF307 Antibody

Sign In for Pricing
View Details