Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Progesterone receptor (PRGR), partial, Biotinylated

This Recombinant Human Progesterone receptor (PRGR), partial, Biotinylated spans the amino acid sequence from region 679-913. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Progesterone receptor; PR; Nuclear receptor subfamily 3 group C member 3; PGR NR3C3

UniProt

P06401

Expression Region

679-913

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccl12 (NM_011331) Mouse Tagged ORF Clone
MG200255 10 µg

Ccl12 (NM_011331) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant IKZF1 Antibody
RC-6666-01 50 μL

Recombinant IKZF1 Antibody

Sign In for Pricing
View Details
Recombinant IKZF1 Antibody
RC-6666-02 100 µL

Recombinant IKZF1 Antibody

Sign In for Pricing
View Details
Recombinant IKZF1 Antibody
RC-6666-03 1 mL

Recombinant IKZF1 Antibody

Sign In for Pricing
View Details
Human CLASP1 activation kit by CRISPRa
GA108226 1 Kit

Human CLASP1 activation kit by CRISPRa

Sign In for Pricing
View Details
PPIL2 Antibody
KC-2835-01 50 μL

PPIL2 Antibody

Sign In for Pricing
View Details